Protein Info for PS417_04010 in Pseudomonas simiae WCS417

Annotation: glycine/betaine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 TIGR01186: glycine betaine/L-proline transport ATP binding subunit" amino acids 18 to 365 (348 residues), 350 bits, see alignment E=7.8e-109 PF00005: ABC_tran" amino acids 21 to 167 (147 residues), 131.6 bits, see alignment E=4.7e-42 PF00571: CBS" amino acids 259 to 303 (45 residues), 28.4 bits, see alignment 2.6e-10

Best Hits

Swiss-Prot: 62% identical to OSMV_SALTY: Osmoprotectant import ATP-binding protein OsmV (osmV) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05847, osmoprotectant transport system ATP-binding protein (inferred from 98% identity to pfs:PFLU0812)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProV (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UFV4 at UniProt or InterPro

Protein Sequence (385 amino acids)

>PS417_04010 glycine/betaine ABC transporter ATP-binding protein (Pseudomonas simiae WCS417)
MIELQNLSKTFQSNGKTVTAVNDVSLTVNEGEICVFLGPSGCGKSTTLKMINRLIKPTSG
KILINGEDTTDLDEVTLRRNIGYVIQQIGLFPNMTIEENIVVVPKLLGWDKQKCHDRARE
LMSMIKLEPKQYLHRYPRELSGGQQQRIGVIRALAADAPLLLMDEPFGAVDPINREMIQN
EFFEMQRALNKTVIMVSHDIDEAIKLGDKIAIFRAGKLLQIDHPDTLLAHPADEFVSNFV
GQDSTLKRLLLVKAEDAADNAPSVSPETPVADALELMDEHDRRYMVVTCAENKALGYVRR
RDLHRQTGTCGQYLREFNATAAYDEHLRILLSRMYEFNRSWLPVMDAERVFLGEVTQESI
AEYLSSGKSRGGKTSIVSPAETALA