Protein Info for GFF7880 in Variovorax sp. SCN45

Annotation: Type IV fimbrial assembly protein PilC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 124 to 145 (22 residues), see Phobius details PF00482: T2SSF" amino acids 21 to 143 (123 residues), 109.5 bits, see alignment E=5.5e-36

Best Hits

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>GFF7880 Type IV fimbrial assembly protein PilC (Variovorax sp. SCN45)
RAMLKIPVVGQILHNAAVARFARTLAVTFRAGVPLVEALDTVAGATGNVVYEKAVYRIRD
DVSVGYQVNMAMKQVNLFPHMVIQMTAIGEEAGALDTMLVKVAEFYEQEVNNAVDALSSL
LEPLIMIILGVIVGGMVVAMYLPIFKLAATI