Protein Info for GFF788 in Xanthobacter sp. DMC5

Annotation: Bicarbonate transport ATP-binding protein CmpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 23 to 165 (143 residues), 113.2 bits, E=1.5e-36

Best Hits

Swiss-Prot: 48% identical to SSUB1_XANAC: Aliphatic sulfonates import ATP-binding protein SsuB 1 (ssuB1) from Xanthomonas axonopodis pv. citri (strain 306)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 70% identity to azc:AZC_2276)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Protein Sequence (255 amino acids)

>GFF788 Bicarbonate transport ATP-binding protein CmpD (Xanthobacter sp. DMC5)
MSVPVLSAEGVALSYPGASAPVLEGFDLAIQPGEVVAILGPSGAGKSSLLRVLGGLQRPS
AGTVRMGGTVLEDVHPRLAVAFQDPCLLPWLTLEANVAFGLDFKRQPPVSPAERRSRVDA
AIAEVGLGHARHLPPSALSGGMAQRTALARCLARKPEVLLLDEPFGALDEVTRAEMQDLL
LKVVADFGTAALLVTHDIDEALLVADRVVLIGGAPARQVASWTLDLPRPRRDEVATLGAL
RIDILKALRGAVRRH