Protein Info for GFF787 in Pseudomonas sp. DMC3

Annotation: putative methyltransferase YcgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF05175: MTS" amino acids 36 to 117 (82 residues), 23.6 bits, see alignment E=1.4e-08 PF03141: Methyltransf_29" amino acids 40 to 143 (104 residues), 31.6 bits, see alignment E=2.9e-11 PF01209: Ubie_methyltran" amino acids 42 to 153 (112 residues), 63.1 bits, see alignment E=1e-20 PF13489: Methyltransf_23" amino acids 43 to 194 (152 residues), 65 bits, see alignment E=2.8e-21 PF13847: Methyltransf_31" amino acids 47 to 149 (103 residues), 64.8 bits, see alignment E=3e-21 PF13649: Methyltransf_25" amino acids 49 to 142 (94 residues), 82.4 bits, see alignment E=1.3e-26 PF08242: Methyltransf_12" amino acids 50 to 143 (94 residues), 57.3 bits, see alignment E=9e-19 PF08241: Methyltransf_11" amino acids 50 to 146 (97 residues), 89.3 bits, see alignment E=8.8e-29

Best Hits

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_1891)

Predicted SEED Role

"SAM-dependent methyltransferase YafE (UbiE paralog)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF787 putative methyltransferase YcgJ (Pseudomonas sp. DMC3)
MTSTAQHTQVVQKQFGEQAAAYLSSAVHAQGSEFALLQAELAGQGSARVLDLGCGAGHVS
FHVAPLVREVVAYDLSQQMLDVVAGAAVDRGLSNIITVNGAAERLPFADGEFDFVFSRYS
AHHWSDLGLALREVRRVLKPGGVAAFVDVLSPGSALFDTYLQSVEVLRDTSHVRDYSAAE
WLRQVSEAGLHVRSTTRQRLRLEYSSWVERMRTPDVMRAAIRQLQQSMGNEVREYFEIDA
DGSFSTDVIVLMAER