Protein Info for PS417_03990 in Pseudomonas simiae WCS417

Annotation: ligand-gated channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 761 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF07715: Plug" amino acids 79 to 177 (99 residues), 80.9 bits, see alignment E=9.3e-27 TIGR01783: TonB-dependent siderophore receptor" amino acids 81 to 761 (681 residues), 298.9 bits, see alignment E=4.6e-93 PF00593: TonB_dep_Rec" amino acids 257 to 730 (474 residues), 222 bits, see alignment E=2.8e-69

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 84% identity to pfl:PFL_0864)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TW27 at UniProt or InterPro

Protein Sequence (761 amino acids)

>PS417_03990 ligand-gated channel protein (Pseudomonas simiae WCS417)
MSRTITKIPASSPRMLASAIGVALSASAIAHQAQAAEDTEQKGQRNSISLGATSITGEEQ
DNTSYQVEKASSQKYTAPLVDTPRSVTVVPQQVLKDTAATSLQDALRTVPGITFGAGEGG
NPQGDRPFIRGFDAQGDTYLDGVRDTGGQSREIFDIESIEVSKGPNSSFGGRGSAGGSLN
LVSKTPQARDFTNGGFTYGSDQTRRYVLDVNRQFLDDSAAFRLNLMSHEQNVAGRDAVNY
DRWGVAPSLTFGLGTPTRVNLSYYHMESDDLPDSGIPYGYGSSTATAHVHDKPNDGGDSN
NFYGLKDRDFRKTRADISTFSIEHDLNDNMTLKNTLRHGSTGQDYILTQPDDSKFNVNRF
GTVWRRANSRVSTTTTTTNQTDLFGSFQALGFKHSYSTGLEFTGEETRVSNYTISPNTNP
VCTVAKGSLGGQCTSLSNPNPDDAWTGSIARNYYGTATKATSRGAYVFDTIELDPKWLLN
VGLRYDTFDTVANTDSATGRSKIKEDSQFFNWQAGLVWKPVENASIYASYATSATPAGGL
VGEGSDGNPLSAGAASSDLQPEETVNYELGTKWDLFHDRLSLTAAVFRTEKKNTRILVDA
LTYQNAGESQVDGVELSASGKITDQWQVFAGYSYLDSELVKSGLNGRNGVVSSGSNKGNQ
MPNTPKNTFSLWTTYDVTSKLTIGGGAFYVDQVYGDAGNTVYVPSYTRYDAMASYKLTKN
VDLQLNVQNLTDKLYYDKAFSTHFANQAAGRTALLTTSFHF