Protein Info for GFF784 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02392: alternative sigma factor RpoH" amino acids 29 to 312 (284 residues), 388 bits, see alignment E=2.7e-120 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 63 to 311 (249 residues), 107.4 bits, see alignment E=5.8e-35 PF04542: Sigma70_r2" amino acids 68 to 137 (70 residues), 69.2 bits, see alignment E=3.1e-23 PF04545: Sigma70_r4" amino acids 253 to 309 (57 residues), 53.5 bits, see alignment E=2.1e-18

Best Hits

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 83% identity to dia:Dtpsy_2845)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>GFF784 RNA polymerase sigma factor RpoH (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSHTLAPVATATTGSIAVANPWALVPPLGNLDAYISAVNRLPLLTLEQEQQAARRLRDDN
DLDAAGQLVMSHLRLVVSISRQYLGYGLPHGDLIQEGNVGLMKAVKRFDPDQGVRLVSYA
MHWIKAEIHEYILKNWRMVKLATTKAQRKLFFNLRSRKQGFRADALDGDTHREVLSDNEV
GVMARELNVKPEEVREMETRLSGGDVVLDPAPGDDGEDSFGPIAYLADATHEPTAVLESA
QRDALATEGVARAMSELDERSRRIVSERWLKVNDDGSGGMTLHELAAEYGVSAERVRQIE
VAAMKKMRKALAAYA