Protein Info for PS417_03980 in Pseudomonas simiae WCS417

Annotation: alkaline phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF16655: PhoD_N" amino acids 30 to 132 (103 residues), 75.1 bits, see alignment E=5e-25 PF09423: PhoD" amino acids 146 to 495 (350 residues), 322.2 bits, see alignment E=4.1e-100

Best Hits

KEGG orthology group: K01113, alkaline phosphatase D [EC: 3.1.3.1] (inferred from 98% identity to pfs:PFLU0807)

Predicted SEED Role

"Phosphodiesterase/alkaline phosphatase D"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UCP8 at UniProt or InterPro

Protein Sequence (513 amino acids)

>PS417_03980 alkaline phosphatase (Pseudomonas simiae WCS417)
MSHFDLGRRRVMQAVGAGLLLPGLAPAVIASVKDRPQLTDGVQSGDLLGDRAMIWSRSDR
PARMVVEWDTRSVFSNPRKFISALADNRTDFTARVELTGLPADQAIFYRVHFEDAQTGVA
SEPWFGHLRSVPQQRRDIRFVWSGDTVGQGFGINPDIGGMRIYEAMRLRLPDFFIHSGDT
IYADGPVPAQLTTESGRIWRNITTEAKSKVAETLDEYRGNYRYNLMDENVRRFNAEVPQI
WQWDDHEVVNNWSPSKQLDERYQVKDINTLVGRARQAWLEYSPMRRQSADGGGRIYRKLS
YGPLLEVFVLDMRSYRGPNDDNLGAEKPFLGREQLDWLKRELKGSQAQWKVIAADMPIGL
GVPDGEVSPGVPRWEAIANNDPGAPQGRELEIAELLGFLRAQKVRNHVWLTADVHYCAAH
HYHPDRAAFQDFEPFWEFVAGPLNAGSFGPNPLDKTFGPEVVFEKAPPAQNTSPFAGFQF
FGEVQIDGQTAELTVILRDLDGVSVFEQKLQPA