Protein Info for PS417_03970 in Pseudomonas simiae WCS417

Annotation: 1-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03168: hexose kinase, 1-phosphofructokinase family
  • amino acids 4 to 300 (297 residues), 332.2 bits, E=2.3e-103
• TIGR03828: 1-phosphofructokinase
  • amino acids 4 to 300 (297 residues), 335.3 bits, E=2.9e-104
• PF00294: PfkB
  • amino acids 9 to 285 (277 residues), 170.9 bits, E=2.2e-54

Best Hits

Swiss-Prot: 46% identical to K1PF_HAEIN: 1-phosphofructokinase (fruK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 89% identity to pfs:PFLU0805)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

• fructose degradation (1/1 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (2/4 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• N-acetyl-D-galactosamine degradation (2/5 steps found)
• galactitol degradation (2/5 steps found)
• lactose degradation I (1/5 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

See A0A1N7U6V7 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PS417_03970 1-phosphofructokinase (Pseudomonas simiae WCS417)
MARILTLTLNPALDLTVRLARLEPGEVNRSETLLTHAAGKGVNVAQVLADLGHELTVSGF
LGEGNPQAFEALIAQRGFTDAFIRVPGETRSNIKIAEQDGRVTDINAPGPQVTEQAQNAL
LDKLAQIAPGFDAVVVAGSLPRGVSPQWFKGLLEQLKRYGLKVALDTSGEALRAGLLAGP
WLVKPNTEELAEALDNATDAVSQLHRQGVEHVVVSDGAAGVSWYSPNAALQATPPKVTVA
STVGAGDSLLAGMLHGLLTGDTPEQTLRRATAIAAMAVTQIGFGISDHAQLARLESGVQV
RSLTEQ