Protein Info for PS417_03970 in Pseudomonas simiae WCS417

Annotation: 1-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR03168: hexose kinase, 1-phosphofructokinase family" amino acids 4 to 300 (297 residues), 332.2 bits, see alignment E=2.3e-103 TIGR03828: 1-phosphofructokinase" amino acids 4 to 300 (297 residues), 335.3 bits, see alignment E=2.9e-104 PF00294: PfkB" amino acids 9 to 285 (277 residues), 170.9 bits, see alignment E=2.2e-54

Best Hits

Swiss-Prot: 46% identical to K1PF_HAEIN: 1-phosphofructokinase (fruK) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 89% identity to pfs:PFLU0805)

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U6V7 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PS417_03970 1-phosphofructokinase (Pseudomonas simiae WCS417)
MARILTLTLNPALDLTVRLARLEPGEVNRSETLLTHAAGKGVNVAQVLADLGHELTVSGF
LGEGNPQAFEALIAQRGFTDAFIRVPGETRSNIKIAEQDGRVTDINAPGPQVTEQAQNAL
LDKLAQIAPGFDAVVVAGSLPRGVSPQWFKGLLEQLKRYGLKVALDTSGEALRAGLLAGP
WLVKPNTEELAEALDNATDAVSQLHRQGVEHVVVSDGAAGVSWYSPNAALQATPPKVTVA
STVGAGDSLLAGMLHGLLTGDTPEQTLRRATAIAAMAVTQIGFGISDHAQLARLESGVQV
RSLTEQ