Protein Info for GFF781 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00005: ABC_tran" amino acids 22 to 166 (145 residues), 108.4 bits, see alignment E=4.5e-35

Best Hits

Swiss-Prot: 48% identical to BRAG_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraG (braG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 83% identity to pol:Bpro_3793)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>GFF781 Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MANTLLKVSGLKVAYGGIKAVKGIDLEVREGELISLIGSNGAGKTTTMKAVTGSLAYEAG
DIEYLGKSIKGKGAWDLVKQGLAMVPEGRGVFTRMTITENLQMGAYIRKDKAGIAQDIEK
MFGIFPRLRERKDQLAGTMSGGEQQMLAMARALMSQPKVLLLDEPSMGLSPIMVDKIFEV
VRDVSAQGVTILLVEQNARRALQIADRGYVMDSGEIIMTGVGRDMLDDPKVRAAYLGE