Protein Info for GFF78 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), permease component FhuB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 87 to 104 (18 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details amino acids 372 to 393 (22 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details amino acids 448 to 467 (20 residues), see Phobius details amino acids 473 to 493 (21 residues), see Phobius details amino acids 505 to 524 (20 residues), see Phobius details amino acids 545 to 564 (20 residues), see Phobius details amino acids 569 to 587 (19 residues), see Phobius details amino acids 593 to 619 (27 residues), see Phobius details amino acids 631 to 651 (21 residues), see Phobius details amino acids 660 to 680 (21 residues), see Phobius details PF01032: FecCD" amino acids 43 to 348 (306 residues), 211 bits, see alignment E=1.1e-66 amino acids 388 to 682 (295 residues), 245.7 bits, see alignment E=3e-77

Best Hits

Swiss-Prot: 100% identical to FHUB_SALTY: Iron(3+)-hydroxamate import system permease protein FhuB (fhuB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 91% identity to eco:b0153)

MetaCyc: 91% identical to iron(III) hydroxamate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), permease component FhuB" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (685 amino acids)

>GFF78 Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), permease component FhuB (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSRKREMPDGGAKSVLSDLRFGRFVGRIRRSRHPALLLLALFVAACWLTWVNFSVALPRS
QWQQAIWSPDIDIIEQMIFHYSQLPRLAISLLVGAGLGLVGVLFQQVLRNPLAEPTTLGV
ATGAQLGITVTTLWAIPGALTTQFAALTGACIVGALVFGVAWGKRLSPVTLILAGLVVSL
YCGAINQLLVIFHHDQLQSMFLWSTGTLTQTDWSGVQRLWPQLLGGVMLTLLLLRPMTLM
GLDDGVARNLGLALSLARLAALSLAIVLSALLVNAVGIIGFIGLFAPLLAKMLGARRLLA
RLMLAPLIGALILWLSDQIILWLTRVWMEVSTGSVTALIGAPLLLWLLPRLKSMSAPDMN
ASDRVAAERRHVLAFAVAGGALLLLATWVALSFGRDAHGWTWASGTLLEELMPWRWPRIL
AALMAGVMLAVAGCIIQRLTGNPMASPEVLGISSGAAFGVVLMLFLVPGNAFGWLLPAGS
LGAAATLLIIMIAAGRGGFSPQRMLLAGMALSTAFTMLLMMLQASGDPRMAEVLTWLSGS
TYNATGGQVTRTAIVMVILLAIVPLCRRWLTILPLGGDAARAVGMALTPSRIALLALAAC
LTATATMTIGPLSFVGLMAPHIARMLGFRRTMPHMVISALAGGVLLVFADWCGRMALFPY
QIPAGLLSSFIGAPYFIYLLRKQSR