Protein Info for GFF778 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 236 to 260 (25 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 293 (286 residues), 150.9 bits, see alignment E=2e-48

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 80% identity to pna:Pnap_3208)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF778 High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEVLLQQIINGLVLGSMYALVALGYTMVYGIIGLINFAHGDVLMVGALTSWTVIGWMMNA
STGLPTWLILFLATIIAMVVCATLNFTIEKLAYRPLRNSNRLAPLITAIGMSLLLQTFAM
IIWAPNPKSYPSMLSREPIAIGGAVVSVTQVVILATTAVTLAFLMWLVNRTNLGRAMRAT
AENPRVAALMGIKPDVVISATFIIGAMLAAIAGVMWASNYGTVQHAMGFMPGLKAFVAAV
MGGIGNLAGAVVGGIALGLIESLGAGYLGKLTGGVLGSQYTDIFAFIVLAIVLTLRPSGL
LGERVADRA