Protein Info for GFF777 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates transport permease protein SsuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 201 to 218 (18 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 113 to 282 (170 residues), 71 bits, see alignment E=5.7e-24

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 62% identity to rsq:Rsph17025_0750)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>GFF777 Putative aliphatic sulfonates transport permease protein SsuC (Xanthobacter sp. DMC5)
MSLAETLDKPAFDQSARAGTATASAARRRTGRRGPASPTPLGSVLLGLSFPFALLVAWWW
AARLGLVPEQILPAPATIYETVSSLIADGSLTTHLEVSTHRVLVGFGLGALFGLVFGAAA
GLSPTVRAFLYPPVQAVARVNVLAWMPLLTLFMGIDEPLKYVVIGWSAAIPIILGTARGI
ENVSPAVRELGRVLHFNTRDTLRLVVLPGAVPSIFAGLREGLANAWQTLVLAELFASFEG
LGYLMTWGRQLFQLDLVIIAMIVVALAGLAMDLGLRWVERRAQPWKRGTRDVH