Protein Info for GFF775 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cell division protein FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details PF13491: FtsK_4TM" amino acids 21 to 210 (190 residues), 135.3 bits, see alignment E=3.6e-43 PF17854: FtsK_alpha" amino acids 291 to 391 (101 residues), 104 bits, see alignment E=8.5e-34 PF01580: FtsK_SpoIIIE" amino acids 399 to 608 (210 residues), 245.3 bits, see alignment E=1.1e-76 PF09397: FtsK_gamma" amino acids 719 to 779 (61 residues), 90.4 bits, see alignment 1e-29

Best Hits

Swiss-Prot: 69% identical to FTSK2_RALSO: DNA translocase FtsK 2 (ftsK2) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 72% identity to rfr:Rfer_3178)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (785 amino acids)

>GFF775 Cell division protein FtsK (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTYSLNTLNADRSAAAPAGVSRFAQEIGLVLGAAALAFWLLALLTHSLADPAWSTTGTSA
EVGNWGGRLGALLSDWSYYLLGFSVWWLFLAGVRAWLSTLARWIRGAQGTEDDVVTGDRL
WHRPWARRALFWLALVTLMAASTVLEWSRLYRLEAALPDHAGGVLGHALGPVAMRWLGFT
GSALAMLAVLLVCLPTVFRFSWGHWAEEVGHTLDGWFEARREKREAVEDQRIGEKAARER
EEVVKVERVEIEEHHPVPVVIEPTLVDVPKSERVAKERQKPLFTELPDSKLPQVDLLDSA
PLHQAGVDSQTLEMTSRLIEKKLKDFGVEVRVVAAAPGPVITRYEIEPATGVKGSQIVNL
GRDLARSLSLVSIRVIETIPGKNLMALELPNAKRQTIKLSEILGSQVYNDAKSMLTMGLG
KDIGGQPVVADLAKMPHCLVAGTTGSGKSVGINAMILSLLYKADARDVRLLLIDPKMLEM
SVYEGIPHLLAPVVTDMKHAANGLNWCVAEMEKRYKLMSKMGVRNLAGFNTKIDDATARG
EIIGNPFSLTPEQPEPLERLPYIVVVIDELADLMMVVGKKIEELIARLAQKARAAGIHLI
LATQRPSVDVITGLIKANIPTRLSFQVSSKIDSRTILDQMGAESLLGMGDMLYMPSGTGF
PIRVHGAFVSDDEVHRVVAYLKEQGGEPNYIDGVLESSLGDGEGGDLFGEGGGEGGSGEK
DALYDQAVEIVLKDRKASISYVQRKLKIGYNRAARLLEDMENAGLVSALTSSGQRDILVP
SRSGE