Protein Info for PS417_03935 in Pseudomonas simiae WCS417

Annotation: N-acetyl-anhydromuranmyl-L-alanine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF01510: Amidase_2" amino acids 28 to 169 (142 residues), 120.3 bits, see alignment E=3.8e-39

Best Hits

Swiss-Prot: 55% identical to AMPD_HAEIN: 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD (ampD) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03806, AmpD protein (inferred from 93% identity to pfs:PFLU0798)

MetaCyc: 71% identical to N-acetylmuramoyl-L-alanine amidase (Pseudomonas aeruginosa PAO1)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) AmpD" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U4J9 at UniProt or InterPro

Protein Sequence (187 amino acids)

>PS417_03935 N-acetyl-anhydromuranmyl-L-alanine amidase (Pseudomonas simiae WCS417)
MQLDPTSGWCKGIRHCPSPNYNERPAGEISLLVVHNISLPPAQFATGKVQEFFQNRLDVT
EHPYFEGIADLRVSAHFLIERDGAVTQFVSCLDRAWHAGISQFEGRDTCNDFSLGVELEG
TDDQPFTDAQYASLTNLTRQLLAAYPDITPQRICGHSDIAPGRKTDPGPAFDWTRFRSAL
QDGGHAR