Protein Info for GFF774 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00027: cNMP_binding" amino acids 34 to 118 (85 residues), 85.3 bits, see alignment E=3.4e-28 PF13545: HTH_Crp_2" amino acids 153 to 217 (65 residues), 55 bits, see alignment E=9.8e-19 PF00325: Crp" amino acids 176 to 206 (31 residues), 41.7 bits, see alignment 1.1e-14

Best Hits

KEGG orthology group: None (inferred from 80% identity to pol:Bpro_3800)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (224 amino acids)

>GFF774 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSLLSNLDLIRRVPLFSTLTQAQAESVADSVVKRRFKRGECIVEQGKKSNCLAIVLTGRA
RVVTTDTRGREVILATMNPGDYVGEMSLIDNQPHSATVRAEVQTDVLILGRTEFARCLPE
NTSMAYAVMRGLVQRLRHADRKIESLALMDVYGRVARALLEFAQPDKDGVLTIKDRVSRQ
DVAKMIGASREMVSRVMKDLEDRGFIEVTEEGSTVIKERLNSLG