Protein Info for GFF7703 in Variovorax sp. SCN45

Annotation: GTP cyclohydrolase I (EC 3.5.4.16) type 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02649: GCHY-1
  • amino acids 2 to 179 (178 residues), 148.8 bits, E=1.1e-47

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (4/5 steps found)
• preQ₀ biosynthesis (3/4 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis IV (Plasmodium) (2/3 steps found)
• superpathway of chorismate metabolism (42/59 steps found)
• erythro-tetrahydrobiopterin biosynthesis I (2/4 steps found)
• threo-tetrahydrobiopterin biosynthesis (2/4 steps found)
• tetrahydromonapterin biosynthesis (1/4 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.16

Use Curated BLAST to search for 3.5.4.16

Protein Sequence (188 amino acids)

>GFF7703 GTP cyclohydrolase I (EC 3.5.4.16) type 2 (Variovorax sp. SCN45)
LASDNAGWKRYPVEIDARLVDGHLHLGLRFAVEYSSTCPASAALSRQLNAERFAADFAAA
HPLSTAVVSDWLASERGLAATPHAQRSRADVRVELRPAFDELPLVALIEALETALATPVQ
TAVKREDEQAFARLNAENLRFCEDAARRVAAALSADPRIARFDAEVAHFESLHAHDAVAR
VTGQGARE