Protein Info for GFF767 in Xanthobacter sp. DMC5

Annotation: Putative aliphatic sulfonates-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF13379: NMT1_2" amino acids 42 to 209 (168 residues), 31.5 bits, see alignment E=3.3e-11 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 46 to 326 (281 residues), 210.6 bits, see alignment E=1.5e-66 PF04069: OpuAC" amino acids 64 to 249 (186 residues), 34.4 bits, see alignment E=3.9e-12 PF12974: Phosphonate-bd" amino acids 66 to 199 (134 residues), 29.6 bits, see alignment E=8.9e-11 PF09084: NMT1" amino acids 74 to 264 (191 residues), 46.1 bits, see alignment E=1.2e-15

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 72% identity to bra:BRADO4871)

Predicted SEED Role

"ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>GFF767 Putative aliphatic sulfonates-binding protein (Xanthobacter sp. DMC5)
VSLARSFLFRGLRIARLFLASRSLVAGLALTLALATAAAAQAPTKVRVGYQRSSTLITVL
KTNGTLEKALAPLGVEVSWHEFTSGLPLLEAVNVGSIDFSADVADTVPVFAQAAGAKLVY
VAEEAPSPSAQAILVPANSPITTLEQLKGKKVGVTKGAGSHYLLLVALAKAGLSIRDITP
AYLTPADARAAFVSGNLDAWVAWDPFLASTQSQSGARVLADGTGLANYKRYYLTTEDFSK
RGGKVLDVLFERLKATGEWVKANPGPAAEILAGLWGIDAPTVEKANARRSYKVGPVTRAG
LAEQQKIADVFFAEGVLPKKVDASDAAIWTPSAP