Protein Info for GFF7655 in Variovorax sp. SCN45

Annotation: GlpG protein (membrane protein of glp regulon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details PF01694: Rhomboid" amino acids 39 to 135 (97 residues), 78.2 bits, see alignment E=3.8e-26

Best Hits

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>GFF7655 GlpG protein (membrane protein of glp regulon) (Variovorax sp. SCN45)
MITFVLIAVTVLVSWQAFEKRRLYERLVLWPPGVQRFRQYDRLLTHGFVHADWMHLLFNM
ITLYFFGRAVENVFSQLVGPGMFLLFYLSAIVVAILPSYLRHRRDSGYVSLGASGAVSAV
LFAFVLVDPWNWIIDFVIQ