Protein Info for GFF759 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Lipoprotein signal peptidase (EC 3.4.23.36)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 70 to 89 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 141 to 160 (20 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 13 to 168 (156 residues), 134.7 bits, see alignment E=1.4e-43 PF01252: Peptidase_A8" amino acids 17 to 163 (147 residues), 147.6 bits, see alignment E=1.5e-47

Best Hits

Swiss-Prot: 71% identical to LSPA_POLSJ: Lipoprotein signal peptidase (lspA) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 66% identity to dac:Daci_5385)

MetaCyc: 46% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (170 amino acids)

>GFF759 Lipoprotein signal peptidase (EC 3.4.23.36) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MASKSPNSHLWPWLGLAAALLVADQVTKQWILAVYQLGDSTHVTSFFNLVRVHNTGAAFS
FLAGAGGWQRWFFTAVGVGAAVFIVWMLRSHPGQKLFAFALSCILGGALGNVIDRLWHGY
VVDFLDFHWSFLAGLFPGGHFPSFNLADIAISVGAAALILDEILRVRRRR