Protein Info for GFF758 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Sodium-dependent phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 100 to 117 (18 residues), see Phobius details amino acids 129 to 151 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 203 to 223 (21 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details TIGR00704: Na/Pi-cotransporter II-related protein" amino acids 1 to 301 (301 residues), 248.8 bits, see alignment E=5.1e-78 PF02690: Na_Pi_cotrans" amino acids 9 to 144 (136 residues), 122.6 bits, see alignment E=1.3e-39 PF01895: PhoU" amino acids 338 to 417 (80 residues), 50.4 bits, see alignment E=2.5e-17 amino acids 440 to 523 (84 residues), 29.2 bits, see alignment E=1e-10

Best Hits

Swiss-Prot: 46% identical to YJBB_SHIFL: Uncharacterized protein YjbB (yjbB) from Shigella flexneri

KEGG orthology group: K03324, phosphate:Na+ symporter (inferred from 74% identity to pna:Pnap_3231)

MetaCyc: 46% identical to putative inorganic phosphate export protein YjbB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-470

Predicted SEED Role

"Sodium-dependent phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (550 amino acids)

>GFF758 Sodium-dependent phosphate transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
LDLLAAIALLVWGTHLVRAGVLRVFGSSLRQFLAASMGNRFTAALSGLGVTALVQSSTAT
ALITASFVGRGLIALPAALAVMLGADIGTSLMAVVFSFDLSWLSPLFIFLGVTLFISRQG
TSVGDFGRVLIGLGLLLLALRLISAATSVLTQNPAVQLMLESLTSDLLLEILLGATLAVV
AYSSLAVVLLASSLAVQVVGLEVALGIVLGANLGSGLLAVITTAKSGISTRQVPLGNLLF
KVLGVAIAIWLIPLWLQVVQPLVQDPATLTVLFHLCFNLMVGAVFIGLTKPVARLVNRLL
PLKKDKSPLDRPNHLDPSALATPSLAISCAAREAMHQADVVETMLRGVVTVIRNNDAKLS
QDLRKLDDTVDNLYSSIKYYLTKISRQQLSEAESRRWTDIISFTINMEQIGDTVERVLLD
IEDKKIRKGRSFSEAGMAEITELHARLLDNLRLGMSVFLNGNVRDAQKLVEEKVRFRDME
REYAATHLDRLSGMTPQSMDTSSLHLDLISDLKRINSHICSIAYPILDSAGVLAPSRLRE
PTPPSHASRL