Protein Info for GFF756 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 12 to 44 (33 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 96 to 127 (32 residues), see Phobius details amino acids 153 to 180 (28 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details PF01925: TauE" amino acids 18 to 270 (253 residues), 124 bits, see alignment E=3.9e-40

Best Hits

KEGG orthology group: None (inferred from 82% identity to xau:Xaut_4249)

Predicted SEED Role

"Protein of unknown function DUF81" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF756 hypothetical protein (Xanthobacter sp. DMC5)
MFSNVPVQELVLLVAAMLAGGVLTGLLAGLFGIGGGGVIVPVLYEVFGFLGVDDSVRMQL
CVGTSLAIIIPTAMASHRTHIAKGASLPGVLAKWRIPAIIGIITGSAIAAVAAGWVLQAV
FVAVVSLLGLKSLIGRNDIRIADHLPSSAMMRFYGFFIGLASSLVGISGGGISTNILLLY
GVPIHAAVATSAGIGVIIPIPGVIGYAIAGWPHLSELPPLSIGYVSVIGFLCIAPVATLV
APYGARLAHRLSRRHLEIGFGLFLLLIGARFLVAIIHG