Protein Info for GFF756 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Quinone oxidoreductase (EC 1.6.5.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF08240: ADH_N" amino acids 32 to 135 (104 residues), 46.1 bits, see alignment E=5.9e-16 PF00107: ADH_zinc_N" amino acids 158 to 272 (115 residues), 98.5 bits, see alignment E=4.6e-32 PF13602: ADH_zinc_N_2" amino acids 191 to 329 (139 residues), 83.5 bits, see alignment E=4.2e-27

Best Hits

Swiss-Prot: 56% identical to QOR_PSEAE: Quinone oxidoreductase (qor) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 80% identity to adk:Alide2_3733)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF756 Quinone oxidoreductase (EC 1.6.5.5) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSEQTSRAVRIHAVGGPEQLVVDTVSVGEPGPGQVRIRHHAIGLNFIDVYQRTGLYPFPM
PLALGMEGAGVIEAVGEGVTHLKAGDRAAYAANPPGSYCDLRVLPAMNVCRLPDAIDFET
GAAMMLKGLTAQYLLKRCRPVEGLEAGDFVLFHAAAGGVGLIACQWAKSLGLQLIGTAGS
DEKCALALEHGAAHAINYRTEDFAARVKDITNGQGVKVVYDSVGKDTFDKSLDCLRPFGL
MASFGNASGPVPPFAPGILASKGSIYVTRQTLFSHITSRERTQAMADDLFAVVEGGKVKV
RIDQRFPLTDVQAAHKSLEARATTGCTVLLP