Protein Info for GFF7554 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 16 to 34 (19 residues), see Phobius details amino acids 45 to 71 (27 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 12 to 97 (86 residues), 23 bits, see alignment E=5.2e-09 PF01757: Acyl_transf_3" amino acids 15 to 135 (121 residues), 56.2 bits, see alignment E=3.1e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>GFF7554 no description (Variovorax sp. SCN45)
MPHPLPAEAAPRLPQLDALRGLAALYVVVYHVMAMPDPHLPVPTWAVPAIAMGGSGVVLF
FVMSAFSLCLTWPRHAASGAALRSFYLSRVFRIAPLLLALLAVMVLRDQLREPTRYGAQE
IAWNASMLFGLSPQWQAGIV