Protein Info for GFF755 in Variovorax sp. SCN45

Annotation: Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 632 PF05157: MshEN" amino acids 61 to 164 (104 residues), 65.2 bits, see alignment E=5.9e-22 PF00437: T2SSE" amino acids 226 to 496 (271 residues), 290.6 bits, see alignment E=9.8e-91

Best Hits

KEGG orthology group: None (inferred from 79% identity to vpe:Varpa_4504)

Predicted SEED Role

"Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (632 amino acids)

>GFF755 Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB (Variovorax sp. SCN45)
MSSTEVTLPEQLLRALELQSHAPVARIGEALVSLGMVSDEQLREGLVRQRLEPQVPLGEM
LVRMGVVSHGQLQTALVRKMGYPLVNLNLFPAAADALRKVGHGVARRLQVMPLMLHQGRL
VVALDDPSSRHSALEEIEFIAQMKVTPVVGQCLDLDSVLGAAYEKIGEPSIGIFSTNVDP
GRPLEFDLAGTSELLQTLEKEGPASAPPAEAPIEQSDNSLVRMINSMILEAHREGASDIH
IESYPGQEKTRIRFRRDGLLYTYLELPPSYRNAIVARVKIMCDLDISEKRNPQDGKINFA
KYSPQHRIELRVATIPTNNGLEDVVMRILASSKPIPMSELGLSPNNLAQLTKAVERPYGM
VLCVGPTGSGKTTTLHSALMQINTPERKIWTAEDPVEITQPGLRQVQINPRIDWTFAKAL
RAFVRADPDVIMVGEIRDEETAKTAIEASLTGHLVLSTLHTNSAPETVTRLLDMGMDPFN
FADSLLAVLAQRLVRRLCSRCTSSSPASSERIEELLDDYLHAFGTREDDAGRQRNAVRDV
WLRRYGREGRLHAYTSVGCKHCGGTGFKGRVGIHELMVMSKTLRRLVQTGARAEELQLAA
LQEGMRTLRQDGIEKVLAGHTTVEEVRATSNV