Protein Info for GFF755 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 45 to 63 (19 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 294 to 311 (18 residues), see Phobius details PF00892: EamA" amino acids 14 to 146 (133 residues), 80.1 bits, see alignment E=9.7e-27 amino acids 162 to 311 (150 residues), 42.1 bits, see alignment E=5.5e-15

Best Hits

KEGG orthology group: None (inferred from 60% identity to har:HEAR1438)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>GFF755 Permease of the drug/metabolite transporter (DMT) superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSENASVRLNPTTLLLLVIPPLMWAGNAVVGRMMQGVVPPVTLNFLRWTLAFVLLLPFAG
RVLRPGPDGLWPHWRRFALLGLLGVGCYNAFQYVALKTSTPMNVTLVAASMPVWMLVLGR
IFYGVAISRRAALGALLSLCGVAVVLSHGNLDHLLAVKLVPGDGWMLLASLLWAWYSWLL
VRPKPGTEPAHIKADWAAFLLAQITMGLLWSGLFAAGEWLTLPPMADGQSPIQWGWPLAA
ALVYVAVGPSLVAYRCWGAGVARVGPAMAAFFNNLTPLFAALLSATLLGEPPRLFHAIGF
VLIVGGILVSSRK