Protein Info for GFF753 in Xanthobacter sp. DMC5

Annotation: ATP-dependent DNA helicase RecQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 605 TIGR00614: ATP-dependent DNA helicase, RecQ family" amino acids 12 to 459 (448 residues), 514.9 bits, see alignment E=2e-158 TIGR01389: ATP-dependent DNA helicase RecQ" amino acids 12 to 604 (593 residues), 820.6 bits, see alignment E=7.6e-251 PF00270: DEAD" amino acids 27 to 182 (156 residues), 82.8 bits, see alignment E=6.3e-27 PF00271: Helicase_C" amino acids 224 to 328 (105 residues), 67.6 bits, see alignment E=2.7e-22 PF16124: RecQ_Zn_bind" amino acids 340 to 402 (63 residues), 65 bits, see alignment E=2.1e-21 PF09382: RQC" amino acids 404 to 515 (112 residues), 148.2 bits, see alignment E=2.2e-47 PF00570: HRDC" amino acids 536 to 602 (67 residues), 82.1 bits, see alignment E=5.4e-27

Best Hits

KEGG orthology group: K03654, ATP-dependent DNA helicase RecQ [EC: 3.6.4.12] (inferred from 90% identity to xau:Xaut_4306)

Predicted SEED Role

"ATP-dependent DNA helicase RecQ" in subsystem DNA-replication or DNA repair, bacterial RecFOR pathway

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.12

Use Curated BLAST to search for 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (605 amino acids)

>GFF753 ATP-dependent DNA helicase RecQ (Xanthobacter sp. DMC5)
MSALLDDSAPLEVLRHVFGYEAFRGRQREIVEHVVAGGDALVLMPTGGGKSLCYQVPALV
RPGTGIVVSPLIALMHDQVQALRQLGVKAAMLNSSLAPGEGRQVERALAMGDLDLLYVAP
ERLLTDGFLNLLDGARISLFAIDEAHCVSQWGHDFRPEYRQLTILHERYPGVPRMALTAT
ADGPTRREIVERLNLEEGQVFLSSFDRPNIRYRIAPKANPRVQLKAFLDAHDGEAGIIYC
MSRAKVEATAEMLSTEGRTALPYHAGLDADTRARHQDRFLKEEGVVMVATIAFGMGIDKP
DVRFVVHLDLPKSIEAYYQETGRAGRDGLPSETLLLYGVEDVAKLIQFVDGSDAPEARKR
VERSKLDALLGLAETASCRRQVLLKYFEEDLPQPCGNCDTCLNPPRTFDGTEAAQKLLSC
VYRTGERFGAGHVIDVLRGDANDKVTKFGHDKLSTFGIGGNFSRDEWRAVVRQLVAMGYL
WVDVEGHGSLGLTEKCRPVLRGEERVELKAEARPRAARVTGGGRGPSAALADPADEALFQ
KLKKLRLELARAQGVPPYVIFHDTTLMAIAELKPTSMKALGMISGIGEAKLMRYGQQFLQ
VIAEG