Protein Info for GFF753 in Variovorax sp. SCN45

Annotation: Methyl-accepting chemotaxis sensor/transducer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 190 to 211 (22 residues), see Phobius details PF02203: TarH" amino acids 2 to 173 (172 residues), 25.8 bits, see alignment E=1.9e-09 PF12729: 4HB_MCP_1" amino acids 5 to 180 (176 residues), 52.2 bits, see alignment E=1.2e-17 PF00672: HAMP" amino acids 209 to 261 (53 residues), 31.4 bits, see alignment 4e-11 PF00015: MCPsignal" amino acids 325 to 480 (156 residues), 189.9 bits, see alignment E=6.9e-60

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 71% identity to vap:Vapar_4186)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>GFF753 Methyl-accepting chemotaxis sensor/transducer protein (Variovorax sp. SCN45)
MFLSNVSIGKRLAIVLGLILALFLATSVAAVFKLRQLSVEIDTMIEDNVKTERAGADWLR
HTTAGVQRAAAIAKSSDSSLIDYFAPATAASIKDTNELQKFIEGKLVKPEEKQLLEKVAT
LRKGYLASREEVSKAKVSGDLAGANRLFDSQFQPTSTSYIAGVQQVVNLQREQLDAAAAR
ANNLRAQTSTLLIVCSTVSLVLGALLAWFLARSITRPLHNAETIAQAIADMDLTGKPQHS
YANDETGHLLRALDLMRTALQGSLTQVHGVVMNVSTASTQIATGNQDLSSRTEEQASSLE
ETAASIEELTSTVKQNADNARQANQLATSASEVAVRGGSVVFQVVETMGSINASSKKIVD
IISVIDGIAFQTNILALNAAVEAARAGDQGRGFAVVASEVRNLAQRSAAAAKEIKTLIGN
SVEKVEEGSRQVADAGRTMDEIVGSVKRVTDIMGEISAASQEQTSGIEQINQAITQMDQA
TQQNAALVEEASAAAQSLQEQAGSLAQIVGQFKLEHGHGAPAAAHGLRAIAGQKASRGLA
MPELGFQ