Protein Info for GFF750 in Xanthobacter sp. DMC5
Annotation: Single-stranded DNA-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 61% identical to SSB_CAUVC: Single-stranded DNA-binding protein (ssb) from Caulobacter vibrioides (strain ATCC 19089 / CB15)
KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 74% identity to azc:AZC_2886)MetaCyc: 52% identical to ssDNA-binding protein (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (186 amino acids)
>GFF750 Single-stranded DNA-binding protein (Xanthobacter sp. DMC5) MAGSVNKVILVGNLGRDPEVKSFQNGGRVCNLSIATSENWRDKASGERRERTEWHRVVIF NENLVGVAERFLKKGSKVYIEGQLETRKYEKDGRETYTTEVVLRPYRGELTLLDGREGGG AGADEFGGGSDFGSASPMGGGGGSFGGYSGGGASGGGRRPAPAGGGMGGGSGGGRPAADL DDEIPF