Protein Info for GFF749 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Tricarboxylate transport membrane protein TctA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 45 to 71 (27 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 150 to 182 (33 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 375 to 396 (22 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 439 to 469 (31 residues), see Phobius details amino acids 489 to 512 (24 residues), see Phobius details PF01970: TctA" amino acids 22 to 464 (443 residues), 368.2 bits, see alignment E=2.4e-114

Best Hits

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>GFF749 Tricarboxylate transport membrane protein TctA (Hydrogenophaga sp. GW460-11-11-14-LB1)
MEFSWWDALAQGLAAVWGWQALGLIALGVLVGSVFGALPGLGPVAAIALLLPATLGLPSL
PALLVLAGVYYGAQYGGSLPAIVLDQPGEASSVMTSHDGHPMALQGRAGVALSMATLSSF
AAGCLAVAVVVLLAPAVVSLGLQFGSPERFLLLVVGLVGATVLASGSFLKALAMTVLGLL
LGLTGWDGHTGSARFVPEALEPWMGRHHGLTDGVGFIALALGFFVVAPVAAELAGLSALA
PGAPAREAAPGTPVVSGMATRPTRQELKDALPALLRGTGLGAVLGVVPGGGALLSSLAAY
RLEAVVSRHRTPPLGQGNLRGVAAPEAANNAGAQTAYLPMLALGLPPNTVMALLLGALGL
HAIQPGPSVMGTQPTLFWGLLVSMWVGNLFLLLLNLPLARWWAPALLAVLRLPRRALLTA
LLVAAGLGALALGPHGWGVWLVMALGLLGFVLQRLGCEGVALLLGFVLAPGLEEHLRRAL
QLSRGNWFVFIERPVSALLLMAAVLLLLVVVLQPRRRAVD