Protein Info for GFF7457 in Variovorax sp. SCN45

Annotation: Mobile element protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF13384: HTH_23" amino acids 33 to 78 (46 residues), 36.1 bits, see alignment 1e-12 PF13518: HTH_28" amino acids 35 to 83 (49 residues), 34 bits, see alignment 6.3e-12 PF13551: HTH_29" amino acids 35 to 92 (58 residues), 46.5 bits, see alignment E=7.9e-16 PF13565: HTH_32" amino acids 61 to 132 (72 residues), 53.9 bits, see alignment E=5.5e-18 PF13358: DDE_3" amino acids 173 to 318 (146 residues), 72.7 bits, see alignment E=7.7e-24

Best Hits

KEGG orthology group: None (inferred from 96% identity to ajs:Ajs_1754)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (361 amino acids)

>GFF7457 Mobile element protein (Variovorax sp. SCN45)
MNGRPKTPLVLSATEREQLIALTKRRKTAQALALRARIVLACAEGADNNVVAARLRVTQQ
TVSKWRGRFVQKRLDGLLDAPRPGAPRTIDDARVDAVIARTLESVPAGATHWSTRSMARA
MDVSQTAVTRIWRAFGLQPHRQETFKLSSDPLFVEKVRDIVGLYLDPPLKAMVLCVDEKS
QIQALDRTQPILPLAPGIPERRTHDYMRHGTTTLFAALDIATGEVIGELHRRHRSTEFLQ
FLRTIEANVPAALDVHLVMDNYGTHKTASIKAWFARHPRFHVHFTPTSASWLNQVERWFA
TLTEKYIRRGTHRSTRQLEQAIRQYLELNNADPKPFVWAKSAEDILASVERFCLRISNSG
H