Protein Info for PS417_03785 in Pseudomonas simiae WCS417

Annotation: pilus assembly protein PilV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 20 to 46 (27 residues), see Phobius details PF07963: N_methyl" amino acids 15 to 39 (25 residues), 28.2 bits, see alignment 5.1e-11 TIGR02523: type IV pilus modification protein PilV" amino acids 17 to 89 (73 residues), 89.3 bits, see alignment E=3.2e-29 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 19 to 39 (21 residues), 21.1 bits, see alignment (E = 2e-08)

Best Hits

KEGG orthology group: K02671, type IV pilus assembly protein PilV (inferred from 84% identity to pfs:PFLU0773)

Predicted SEED Role

"Type IV fimbrial biogenesis protein PilV" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TUR7 at UniProt or InterPro

Protein Sequence (161 amino acids)

>PS417_03785 pilus assembly protein PilV (Pseudomonas simiae WCS417)
MPACPNTGFPQDLSRHQIGMTLIEVLVAVLILAIGLLGTAVIQLNALKYTDSSRMTSQAS
FIAYDMLDRIRANSAVDYAWGRAERAPASSASASVRDLDLHDFEANILGFAGASAKGSVS
VSAGEVTVSISWDDSRGANRPGARETFTLTSRISDESRGAQ