Protein Info for GFF7426 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 637 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 276 to 300 (25 residues), see Phobius details amino acids 308 to 331 (24 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 331 (283 residues), 119.8 bits, see alignment E=2.4e-38 PF00005: ABC_tran" amino acids 398 to 555 (158 residues), 108.5 bits, see alignment E=8.3e-35 PF12399: BCA_ABC_TP_C" amino acids 605 to 629 (25 residues), 49.6 bits, see alignment (E = 4.7e-17)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein K01998, branched-chain amino acid transport system permease protein (inferred from 89% identity to vpe:Varpa_1321)

Predicted SEED Role

"ABC-type branched-chain amino acid transport systems, ATPase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (637 amino acids)

>GFF7426 ABC transporter, permease protein 2 (cluster 4, leucine/isoleucine/valine/benzoate) / ABC transporter, ATP-binding protein 1 (cluster 4, leucine/isoleucine/valine/benzoate) (Variovorax sp. SCN45)
MNTPSSTSTASTAANAAPEGRPLVTPRVLTLVFIVALALAWGWLPEFTVSVLSNIGLYAL
VAVGLVLLTGVGGMTSFGQAAFVGMGAYATAWICTSPTAAGWLGGLAGSALVPWLGLLLG
LVLTFALAWALGAVTLKLSGHYLPLCTIAWGLSLYFLLGNMEFLGGQTGITGVPPLVVAG
VSFATPRMLGVVIWAVLLLALWAMHNLLDSREGRAIRALKGGRLMAESMGVDTARHRIKL
FVLAALLAAISGWLYAHMQRFVNPTPFNLNIGIEMLFMAVVGGAGHLWGAVLGATLITLL
KEKLQDVLPALLGTSGNFEVVVFGLLMLFVLQRFADGLWPTIARLARRWVREVPRAAGAG
PAASTTAQLAQRAVPAAGTLLLQADGVSKRFGGLVANNDISMTLKAGEVHALIGPNGAGK
STFFNMISGVDDPTTGEVRLVGQPMSGKPSRAFASLGLGRTFQHVRLLGQRSVVENVALG
AHLRAKRGWLAAMLRLDRAEEAALMAEARRQIERCGLGAHADTPAASLSLGQQRVVEIAR
ALASQPSVLLLDEPAAGLRHLEKRALSELLGQLRAEGLGILVVEHDMEFVMNLADRITVL
EFGTVIATGTPAEVQANPRVLEAYLGGADDELLEDAR