Protein Info for PS417_03750 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 83 to 111 (29 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 188 to 205 (18 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 441 to 466 (26 residues), see Phobius details amino acids 478 to 499 (22 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 2 to 498 (497 residues), 531.8 bits, see alignment E=9.2e-164 PF03023: MurJ" amino acids 28 to 477 (450 residues), 512.2 bits, see alignment E=5.8e-158

Best Hits

Swiss-Prot: 72% identical to MURJ_SALTY: Probable lipid II flippase MurJ (murJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03980, virulence factor (inferred from 99% identity to pfs:PFLU0766)

MetaCyc: 72% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1UTP5 at UniProt or InterPro

Protein Sequence (512 amino acids)

>PS417_03750 membrane protein (Pseudomonas simiae WCS417)
MNLLKSLAAVSSITMISRVLGFVRDTLLARIFGASMATDAFFIAFKLPNLLRRIFAEGAF
SQAFVPILAEYKTQQGEEATRTFIAYVSGLLTLVLMLVTLLGMLAAPWVIWATAPGFANT
PEKFALTTDLLRVTFPYILLISLSSLAGAILNTWNRFSVPAFVPTLLNVSMIIFALFLTP
YFDPPVMALGWAVLAGGLAQLLYQLPHLKKIGMLVLPRLNLKDTGVWRVMRNMLPAILGV
SVSQISLIINTAFASLLVSGSVSWMYYADRLMELPSGVLGVALGTILLPTLARTYASKDR
QEYSRILDWGLRLCFVLVLPCALALGILAEPLTVALFQYGQFDAHDALMTQHALIAYSVG
LLGIIVIKVLAPGFYAQQNIRTPVKIAIFTLIVTQLLNLVFIGPLAHAGLALAISAGACI
NAGLLFYQLRKQQMFQPQPGWGLFALKLLVAVGVMSAVLLGLMHFMPAWDEGHMLERFLR
LGVLVVAGVVVYFGMLLAQGFRLRDFNRKSLG