Protein Info for GFF7379 in Variovorax sp. SCN45

Annotation: Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 PF02771: Acyl-CoA_dh_N" amino acids 6 to 116 (111 residues), 107.1 bits, see alignment E=1.7e-34 PF02770: Acyl-CoA_dh_M" amino acids 122 to 215 (94 residues), 87.5 bits, see alignment E=1.4e-28 PF00441: Acyl-CoA_dh_1" amino acids 227 to 377 (151 residues), 170.3 bits, see alignment E=7.9e-54 PF22924: ACOX_C_alpha1" amino acids 241 to 377 (137 residues), 30.5 bits, see alignment E=7.7e-11 PF08028: Acyl-CoA_dh_2" amino acids 244 to 364 (121 residues), 81 bits, see alignment E=2.6e-26

Best Hits

Swiss-Prot: 54% identical to ACAD8_HUMAN: Isobutyryl-CoA dehydrogenase, mitochondrial (ACAD8) from Homo sapiens

KEGG orthology group: None (inferred from 97% identity to vap:Vapar_3255)

MetaCyc: 35% identical to L-cysteinyl-[NRPS] dehydrogenase (Streptomyces clavuligerus)
RXN-16875

Predicted SEED Role

"Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 1.3.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>GFF7379 Branched-chain acyl-CoA dehydrogenase (EC 1.3.99.12) (Variovorax sp. SCN45)
MNFELSEEQNAFAQTARDFAQAEFAPHAAQWDAEAFFPKEAIAKAGELGFCGLYAPERIG
GLGLPRLDSALVFEEMAAVDPSTTAFITIHNMATWMLGTWATDAVAQQWGEELTSGRKLA
SYCLTEPGAGSDAGSLKTRAELQGAEYVINGGKAFISGAGSTDVLVLMARTGGAGASGIS
AFAVPADAPGISYGKKEHKMGWNSQPTRTINFDNVRIPAQNLLGKEGEGFRIAMKGLDGG
RINIATCSVGAAQGALDAARRYLHERQQFGKPLASFQALQFKLADMATELVAARQMVRLA
ASKLDAGHADASTYCAMAKRFATDAGFNVCNDALQLHGGYGYLSEFPLERLVRDARVHQI
LEGTNEIMRVIVARKLLEGDSDIR