Protein Info for GFF7361 in Variovorax sp. SCN45

Annotation: Acyl-coenzyme A thioesterase PaaD (Pse.pu.) (E. coli PaaI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details TIGR00369: uncharacterized domain 1" amino acids 24 to 133 (110 residues), 70.4 bits, see alignment E=1.4e-23 TIGR02286: phenylacetic acid degradation protein PaaD" amino acids 26 to 135 (110 residues), 123.7 bits, see alignment E=4.2e-40 PF03061: 4HBT" amino acids 53 to 127 (75 residues), 33.5 bits, see alignment E=2.1e-12

Best Hits

Swiss-Prot: 37% identical to PAAI_ECOLI: Acyl-coenzyme A thioesterase PaaI (paaI) from Escherichia coli (strain K12)

KEGG orthology group: K02614, phenylacetic acid degradation protein (inferred from 52% identity to nha:Nham_0937)

MetaCyc: 37% identical to phenylacetyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-; 3.1.2.-

Predicted SEED Role

"Phenylacetic acid degradation protein PaaD, thioesterase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>GFF7361 Acyl-coenzyme A thioesterase PaaD (Pse.pu.) (E. coli PaaI) (Variovorax sp. SCN45)
MSGEEERRMAESCAQLMSASDKTLQRFGMTVDAIGPGTARLSMEFDETAVNGFGMAHGGL
IFLLADSAFAYACNSRNHMAVGQFCTIAFIKAGLNRGRYTATAEERSLTGRSGIYDVAVR
DADHQLIAEFRGHSRLIEGTHFPQ