Protein Info for GFF7323 in Variovorax sp. SCN45

Annotation: Transcriptional response regulatory protein GlrR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00072: Response_reg" amino acids 9 to 117 (109 residues), 101.7 bits, see alignment E=6.9e-33 PF00158: Sigma54_activat" amino acids 142 to 308 (167 residues), 243.4 bits, see alignment E=2.7e-76 PF14532: Sigma54_activ_2" amino acids 144 to 313 (170 residues), 62.2 bits, see alignment E=1.7e-20 PF07728: AAA_5" amino acids 166 to 277 (112 residues), 27.6 bits, see alignment E=6.7e-10 PF25601: AAA_lid_14" amino acids 315 to 388 (74 residues), 80.2 bits, see alignment E=2.1e-26

Best Hits

Swiss-Prot: 58% identical to QSEF_ECO57: Transcriptional regulatory protein QseF (qseF) from Escherichia coli O157:H7

KEGG orthology group: K07715, two-component system, NtrC family, response regulator YfhA (inferred from 96% identity to vap:Vapar_0965)

Predicted SEED Role

"Putative sensory histidine kinase YfhA" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF7323 Transcriptional response regulatory protein GlrR (Variovorax sp. SCN45)
MSTTGARLLVVDDDPDMLRLLSMRLSSAGYQVTAVTSAETALTQLEIEHPQLVLSDVRLP
GRDGLQLFDEIRKRHPSLPVILLTAHGTIPDAVEATARGVFTYLTKPYDGRELLDKIAQA
LALGAPATTPSKAGDDSWRSEIVSRSNRMAELLAEARMVAKSDASVLLRGDSGAGKELLA
RAIHKASARADKPFVAVNCGAIPEALLESELFGHMKGAFTDAHANHKGLFQQADGGTLLL
DEIGDMPPALQVKLLRVLQERAVRPLGASQSIQVDVRIVSATHRDLDAAMEAGQFREDLY
YRLNVVTLTLPPLSARREDIPLLANHFLQRLSTKYGKRLSGFAPEALKALTTAAWPGNVR
QLFNVVEQVCALSSSPLIPLALVQRALRVPSVEVQTYAEAKQRFERDYLVGLLKLTDGNV
ADAARLADRNRTEFYRLLQKHELTPGHFKADAVAGGSDPVAE