Protein Info for GFF7320 in Variovorax sp. SCN45

Annotation: tRNA-i(6)A37 methylthiotransferase (EC 2.8.4.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 3 to 435 (433 residues), 481.1 bits, see alignment E=3e-148 TIGR01574: tRNA-i(6)A37 thiotransferase enzyme MiaB" amino acids 3 to 438 (436 residues), 575 bits, see alignment E=1.2e-176 PF00919: UPF0004" amino acids 3 to 101 (99 residues), 108.6 bits, see alignment E=2e-35 PF04055: Radical_SAM" amino acids 148 to 323 (176 residues), 96.8 bits, see alignment E=2.5e-31 PF01938: TRAM" amino acids 377 to 438 (62 residues), 44 bits, see alignment E=2.5e-15

Best Hits

Swiss-Prot: 83% identical to MIAB_ACIAC: tRNA-2-methylthio-N(6)-dimethylallyladenosine synthase (miaB) from Acidovorax citrulli (strain AAC00-1)

KEGG orthology group: K06168, bifunctional enzyme involved in thiolation and methylation of tRNA (inferred from 97% identity to vpe:Varpa_1024)

MetaCyc: 63% identical to isopentenyl-adenosine A37 tRNA methylthiolase (Escherichia coli K-12 substr. MG1655)
RXN0-5063 [EC: 2.8.4.3]

Predicted SEED Role

"tRNA-i(6)A37 methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase or tRNA processing

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>GFF7320 tRNA-i(6)A37 methylthiotransferase (EC 2.8.4.3) (Variovorax sp. SCN45)
MKKVFIKTFGCQMNEYDSDKMADVLNAAQGYEPTQNVDEADLILFNTCSVREKAQEKVFS
DLGRVKHLKAKGVKIGVGGCVASQEGQAIIARAPYVDIVFGPQTLHRLPEMLNDRERLDR
PQVDISFPEIEKFDHLPPARVEGATAFVSIMEGCSKYCSYCVVPYTRGEEVNRPLDDVLV
EIAGLADQGVREITLLGQNVNAYRGKMGDTAEIADFALLIEYVAEIPGIERIRYTTSHPN
EFTPRLIEAYAKVPQLVSHLHLPVQHGSDRILMAMKRGYTAMEYKSTVRKLRAIRPELAL
SSDFIVGFPGETDDDFNKMMKLIDDCQFDASFSFIFSPRPGTPAAALHDDTPHEVKLARL
HTLQAVIDANVKRFGQALVGTTQRVLVEGASRKDANELMGRTACNRVVNFEGDARLVGQM
TDLRITRSLAYTLRGEVVTNESPMALAH