Protein Info for GFF731 in Xanthobacter sp. DMC5

Annotation: Leu/Ile/Val-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 24 to 361 (338 residues), 216.9 bits, see alignment E=9.3e-68 PF13433: Peripla_BP_5" amino acids 26 to 362 (337 residues), 68.5 bits, see alignment E=9.2e-23 PF01094: ANF_receptor" amino acids 47 to 359 (313 residues), 90.2 bits, see alignment E=2.2e-29

Best Hits

Swiss-Prot: 56% identical to LIVB1_BRUME: Leu/Ile/Val-binding protein homolog 1 (BMEI0263) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 83% identity to xau:Xaut_3905)

MetaCyc: 44% identical to branched chain amino acid/phenylalanine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid ABC transporter, amino acid-binding protein (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>GFF731 Leu/Ile/Val-binding protein (Xanthobacter sp. DMC5)
MKKLLMASLALGAGLVLAAQAQAQVKIAVAGPITGDLAAVGAQLKNGTEQAIADINASGG
ILGQKIEFLVGDDGGKPEQGKSAANKLITDGAKFVIGHYNSGVSIPTSQDYEEAGVLQIS
PASTNPTFTERKMWNTFRTCGRDDQQGAVAGAYILKNFKGKKIAVVHDKTPYGKGLADET
QKSLNKGGMKEVLYEGINPKEKDYSALVSKIKASGADLVYFGGLYPEAGLIVRQMRDQGL
KTVLMGGDGMIDKEFWSIAGDGATGTLTTFGPDPRKNPAAKAIVDKFKAKGVDPEGYVLY
SYAGVQVIKQAAEAAKSLDPKKVAEKIHSGMKFDTVLGPLTFDKKGDITKLDYVVYVWKD
GTYSEL