Protein Info for GFF73 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Periplasmic fimbrial chaperone StfD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00345: PapD_N" amino acids 27 to 144 (118 residues), 117.7 bits, see alignment E=3.3e-38 PF02753: PapD_C" amino acids 168 to 228 (61 residues), 46.3 bits, see alignment E=4.3e-16

Best Hits

Swiss-Prot: 62% identical to YFCS_ECOLI: Probable fimbrial chaperone YfcS (yfcS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to spt:SPA0203)

Predicted SEED Role

"Periplasmic fimbrial chaperone StfD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF73 Periplasmic fimbrial chaperone StfD (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMSLKRYNLAAVLLLLLGGYGSAQAAIAPDRTRLVFRGEDKSISVDLKNANSKLPYLAQS
WVEDEKGVKITSPLIVVPPVQRIEPSAIGQVKIQGMPALASLPQDRETLFYYNVREIPPQ
SDKPNTLQIALQTRIKVFYRPQALSKIDMQHPWQYKITLQRQGNGYQVSNTTGYYVVLSN
ASNRMDGTPARGFSPLVIAPKSNVTLGGDASELGHSPVLTYVNDYGARLPLIFNCTDNSC
AVDEAKSRKS