Protein Info for GFF7298 in Variovorax sp. SCN45

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF01113: DapB_N" amino acids 19 to 140 (122 residues), 130 bits, see alignment E=5.4e-42 TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase" amino acids 19 to 280 (262 residues), 325.9 bits, see alignment E=1.1e-101 PF05173: DapB_C" amino acids 143 to 279 (137 residues), 153.4 bits, see alignment E=2.8e-49

Best Hits

Swiss-Prot: 72% identical to DAPB_CUPNJ: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 92% identity to vpe:Varpa_0435)

MetaCyc: 62% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>GFF7298 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (Variovorax sp. SCN45)
VTESISTSSSSNSASAPRRVAIAGASGRMGHMLIEAVRNAPDLRLAGALDIAGSPALGTD
AGAFLGFNSGVSIVSDLRAGLKDAQVLIDFTRPEGTLAHLAVCRELGVQAVIGTTGFSDA
QKAEIAEIAKDIAIMMAPNMSVGVNVTLKLLEMAAKAMSTGYDIEIIEAHHRHKVDAPSG
TALKMGEVIAQALGRDLKNCAVYAREGITGERDPSTIGFSAIRGGDIVGDHTVLFAGTGE
RIEITHKSSSRVTYAQGSLRAVRFLAEQRSGLFDMYDVLGLR