Protein Info for GFF7290 in Variovorax sp. SCN45

Annotation: Putative transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details PF06912: DUF1275" amino acids 20 to 234 (215 residues), 135.7 bits, see alignment E=8.8e-44

Best Hits

KEGG orthology group: None (inferred from 84% identity to vap:Vapar_1206)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>GFF7290 Putative transmembrane protein (Variovorax sp. SCN45)
VRRLRFLTNRHRAPSTNTALGLLLAFNAGAVNAGGFLVLHMYTSHMTGFASQLADGMVLG
NVTLLLNALGAILAFLTGAAVCAMLVNWGRQHRMHGVYALPLVLEAALMFPFGLMGAITL
TWATPFAVPLTVLLLSFIMGLQNAVASKTSGGSIRTTHMTGNITDMGIEIGKMLYWNGRA
RPAALAVRHDRARMRRAGGLVGMFVLGGAVGALGFKYVGFVCVVPLAALLLALSIPPLLR
DIPRRRASSSVS