Protein Info for GFF727 in Variovorax sp. SCN45

Annotation: FIG01964566: Predicted membrane protein, hemolysin III homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 56 (19 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details PF03006: HlyIII" amino acids 5 to 199 (195 residues), 146.9 bits, see alignment E=3.7e-47 TIGR01065: channel protein, hemolysin III family" amino acids 5 to 202 (198 residues), 184.6 bits, see alignment E=8.1e-59

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 86% identity to vpe:Varpa_2416)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>GFF727 FIG01964566: Predicted membrane protein, hemolysin III homolog (Variovorax sp. SCN45)
MYPGERLNGYSHLLGLLLALPATALLLAKTVPTGDPARIAGALVFSLSAVALYGASTLFH
STRGRLKRMWERADHCAIYLLIAGTYTPFALVTLHGKWGWLLLSAIWGAALFGIWRELRP
PKPGASAKPSLPLYIGMGWLGVLAAVPLAARLDSAGLAWLLIGGVLYTVGTIFYRNRQGF
RHAHGAWHLFVLAGTISHYIAVGWFVL