Protein Info for GFF7263 in Variovorax sp. SCN45

Annotation: Malate dehydrogenase (EC 1.1.1.37)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02615: Ldh_2
  • amino acids 22 to 349 (328 residues), 279.3 bits, E=2.2e-87

Best Hits

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 60% identity to bbr:BB4684)

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (24/26 steps found)
• Bifidobacterium shunt (15/15 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• homolactic fermentation (12/12 steps found)
• superpathway of anaerobic sucrose degradation (17/19 steps found)
• superpathway of glucose and xylose degradation (15/17 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• heterolactic fermentation (15/18 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• gluconeogenesis III (10/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• formaldehyde assimilation I (serine pathway) (9/13 steps found)
• L-histidine degradation V (1/2 steps found)
• mixed acid fermentation (11/16 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• pyruvate fermentation to propanoate I (4/7 steps found)
• reductive TCA cycle II (7/12 steps found)
• methylaspartate cycle (12/19 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (7/13 steps found)
• L-glutamate degradation VIII (to propanoate) (4/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Glyoxylate and dicarboxylate metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.27 or 1.1.1.37

Protein Sequence (364 amino acids)

>GFF7263 Malate dehydrogenase (EC 1.1.1.37) (Variovorax sp. SCN45)
MTHTLPHSPSTVEGAAESRYPADRLLEDVTKLFVHAGLAADKAGTVASTLLDADMMGHAT
HGLVLVPWYLEAIESGSLAHAGEIEVVSDRGACVAWNGHRLPGAWLIHRAIDLSLERIAE
HGVFTITIAGAHHTGALATYLPRLTSRGLMPILSCSGPASSGVAPFGGMRPLFTPNPLAA
GIPTSQDPMLLDISSSITTNNRARQLASEGRRFPGAWAIDAEGHATDDPVAAVQDGGSLL
PVGGLDHGHKGYGMALLVEALTQGLSGLGRNSRPKGVVMNVFLQVIDPAAFGGTDAFVTE
TTWLADACRDNPPRPGVRKVRVPGEQAMVLHRAAQKHGVPLSAGTIAALADRLRAAGLPV
PTPL