Protein Info for GFF725 in Xanthobacter sp. DMC5

Annotation: Dihydrolipoyl dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF07992: Pyr_redox_2" amino acids 5 to 332 (328 residues), 238.9 bits, see alignment E=3.7e-74 TIGR01350: dihydrolipoyl dehydrogenase" amino acids 5 to 471 (467 residues), 582.6 bits, see alignment E=2.8e-179 PF12831: FAD_oxidored" amino acids 6 to 41 (36 residues), 32.7 bits, see alignment 2.4e-11 PF01134: GIDA" amino acids 6 to 66 (61 residues), 28.2 bits, see alignment E=4.7e-10 PF00890: FAD_binding_2" amino acids 6 to 43 (38 residues), 29.8 bits, see alignment 1.7e-10 PF13450: NAD_binding_8" amino acids 9 to 43 (35 residues), 22.1 bits, see alignment 7e-08 PF13738: Pyr_redox_3" amino acids 138 to 316 (179 residues), 37.1 bits, see alignment E=1e-12 PF00070: Pyr_redox" amino acids 182 to 257 (76 residues), 72.2 bits, see alignment E=1.9e-23 PF02852: Pyr_redox_dim" amino acids 352 to 460 (109 residues), 129.3 bits, see alignment E=3.4e-41

Best Hits

Swiss-Prot: 70% identical to DLDH_RHIEC: Dihydrolipoyl dehydrogenase (lpdA) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 95% identity to xau:Xaut_3894)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase complex (EC 1.8.1.4)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>GFF725 Dihydrolipoyl dehydrogenase (Xanthobacter sp. DMC5)
MADTYDIIVIGGGPGGYVAAIRAAQLGFKTAVVEKSHLGGICLNWGCIPTKALLRSAEIY
HYMEHAKDYGLSAEKIGFDAAAVVKRSRGVSSQLATGVGFLLNKNKVDVIWGKATFTAPG
KLKVEAAQNPPKNAKGGGDYTAKHIIVATGARPRALPGLEPDKKLIWTYFEAMVPEKMPK
SLLVMGSGAIGIEFASFYRTMGVDVTVVEVLPQILPVEDEEIAAIARKRFEKQGMKIMSG
AKVTGVTKHADSLTAHVEDAKGAKHDITVDRMISAVGVVGNVEGLGLEAIGVKIERGIVV
TDGLGRTNVPGVYAIGDIAGPPMLAHKAEHEGVICVETIKGLHTHPMDKNKIPGCTYCTP
QIASVGLTEKKAKEAGREIKVGRFPFIGNGKAIALGEPDGLVKTIFDAKTGELLGAHMVG
AEVTELIQGFVVAMNLETTEEDLIHAVFPHPTLSEMMHESVMAAYGRAIHV