Protein Info for GFF722 in Xanthobacter sp. DMC5

Annotation: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01349: pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  • amino acids 4 to 455 (452 residues), 533.6 bits, E=2.2e-164
• PF00364: Biotin_lipoyl
  • amino acids 4 to 77 (74 residues), 70.4 bits, E=1.4e-23
• PF02817: E3_binding
  • amino acids 137 to 172 (36 residues), 60.3 bits, 2.5e-20
• PF00198: 2-oxoacid_dh
  • amino acids 223 to 454 (232 residues), 269.4 bits, E=3.8e-84

Best Hits

Swiss-Prot: 63% identical to ODP2_RHIME: Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (pdhC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00627, pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC: 2.3.1.12] (inferred from 89% identity to xau:Xaut_3891)

Predicted SEED Role

"Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 2.3.1.12)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (4/4 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• pyruvate fermentation to acetate II (3/3 steps found)
• pyruvate fermentation to acetate V (3/3 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.12

Protein Sequence (455 amino acids)

>GFF722 Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex (Xanthobacter sp. DMC5)
MPIEILMPALSPTMEKGNLAKWLKKEGDTVKSGDVLAEIETDKATMEVESIDEGVLAKIL
VPEGSQDVPVNQLIAILAAEGEDVATAAAGKGAPAPAPAAAPAPAAAAPAASPAPAAAPA
PVAAAPAPASNGQGGRVFASPLARRIAKDKGIDLASLSGSGPHGRIVARDLEGAQPGAKP
AAAPAQAAAAAPAPAAAAPAPKATAALTGPTADQVKAMFEAGTYEEVQLDGMRKTIARRL
VESEQLTPHFYLTVDCDLDDLMALREQVNANASKDKDGKPSYRVSVNDFIIKALALALQK
VPAANAVWAEDRILRMKHSDVGVAVAIDGGLYAPIVKKAEQKTLSTISNEMRDLAARART
KKLKPEEYSGGSTSVSNLGMMGMRNFTAIINAPQSSILAVGASEQRAVVKGGEVKVVTQM
TVTMTCDHRVMDGALGAELLSAFKGFIEKPMAMLV