Protein Info for GFF722 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF13489: Methyltransf_23" amino acids 30 to 239 (210 residues), 44.7 bits, see alignment E=5e-15 PF09445: Methyltransf_15" amino acids 46 to 103 (58 residues), 22.8 bits, see alignment E=2.4e-08 PF13847: Methyltransf_31" amino acids 47 to 153 (107 residues), 47.4 bits, see alignment E=6.9e-16 PF03848: TehB" amino acids 47 to 147 (101 residues), 21.5 bits, see alignment E=5.5e-08 PF13649: Methyltransf_25" amino acids 48 to 145 (98 residues), 68.1 bits, see alignment E=3.5e-22 PF08242: Methyltransf_12" amino acids 49 to 146 (98 residues), 42.7 bits, see alignment E=3.2e-14 PF08241: Methyltransf_11" amino acids 49 to 148 (100 residues), 50.4 bits, see alignment E=1.2e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF722 hypothetical protein (Variovorax sp. SCN45)
MTNDFYDELAPLYHLIYPDWNESIRLQGDKLARLIDTEWPGGGARRRVLDVSCGIGTQTL
GLAALGHAVTASDLSPEEIERARHEARTRGLDVAFSVCDMREAHTHHGGGFDIVMSCDNS
MPHLQTDEDLLTTFRQMAACLRPGGGCVVSVRDYAKEERGSNLVKHYGARVENGLRHVLF
QVWDFTDGGKGEHYDLGFFFVTEDLATHAVSTRVMRSRYYAVSTTRLCELMREAGLENVR
RLDDAFFQPVLVGTRPAG