Protein Info for GFF721 in Variovorax sp. SCN45
Annotation: O-acetyl-ADP-ribose deacetylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 70% identical to Y2219_CHLTE: Macro domain-containing protein CT2219 (CT2219) from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
KEGG orthology group: None (inferred from 81% identity to vpe:Varpa_2421)MetaCyc: 48% identical to 2'-O-acetyl-ADP-ribose deacetylase, regulator of RNase III activity (Escherichia coli K-12 substr. MG1655)
RXN0-7013 [EC: 3.1.1.106]
Predicted SEED Role
"COG2110, Macro domain, possibly ADP-ribose binding module"
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.1.1.106
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (168 amino acids)
>GFF721 O-acetyl-ADP-ribose deacetylase (Variovorax sp. SCN45) MTATLRALRADITTLQLDAIVNAANSSLLGGGGVDGAIHRAAGPDLLHECRLLGGCKTGD AKLTKGYRLPARFVIHTVGPVWRGGASGEPELLASCYRRSMALAGEQGVRSIAFPSVSTG IYGYPVELAARVAVDTVREAANDAQSVQEVVFCCFSTGDLAVYEAALA