Protein Info for GFF7202 in Variovorax sp. SCN45

Annotation: ABC transporter, ATP-binding protein (cluster 1, maltose/g3p/polyamine/iron); ABC transporter, ATP-binding protein (cluster 10, nitrate/sulfonate/bicarbonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00005: ABC_tran" amino acids 35 to 174 (140 residues), 113.4 bits, see alignment E=6.9e-37

Best Hits

Swiss-Prot: 45% identical to TAUB_CUPNH: Taurine import ATP-binding protein TauB (tauB) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 82% identity to vap:Vapar_1909)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>GFF7202 ABC transporter, ATP-binding protein (cluster 1, maltose/g3p/polyamine/iron); ABC transporter, ATP-binding protein (cluster 10, nitrate/sulfonate/bicarbonate) (Variovorax sp. SCN45)
MSNLLKPRTSNELDIRGLGKRYTHAQAKGGELQVLEGIDLHVPEGRFVSIVGASGCGKST
LLRLILGLDTQYEGQILLGGQPISGTGRERGIVFQDHRLFPWLTVAQNIAVGLRNAPYTT
REKAELVAEHVALVGLEGFERSWPHQISGGMAQRVAIARGLVNRPRVLLLDEPFGALDAL
TRSRLQNELQRIWQKERITMLLVTHDVEEAVFLGDRVVVMQPSPGRIRRTVNIDLPHPRN
RSDPEFIRLRDDVLGDFIDSGVEPPATPASPRPHGDLPVPGLAPGLQLAW