Protein Info for GFF716 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L,D-transpeptidase YbiS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF03734: YkuD" amino acids 101 to 232 (132 residues), 74.2 bits, see alignment E=1.7e-24 PF17969: Ldt_C" amino acids 237 to 304 (68 residues), 84.4 bits, see alignment E=7e-28

Best Hits

Swiss-Prot: 92% identical to YBIS_ECOLI: Probable L,D-transpeptidase YbiS (ybiS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to sed:SeD_A0935)

MetaCyc: 92% identical to L,D-transpeptidase LdtB (Escherichia coli K-12 substr. MG1655)
RXN0-5401

Predicted SEED Role

"L,D-transpeptidase YbiS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF716 L,D-transpeptidase YbiS (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNMKLTTLFAAAFAVVGFCKTASAVTYPLPTDGSRLIGQNQVITVPEGNTQPLEYFAAEY
QMGLSNMLEANPGVDTFLPKGGTVLNIPQQLILPDTVHEGIIINSAEMRLYYYPKGTNTV
IVLPIGIGQLGKDTPINWTTKVERKKAGPTWTPTAKMHAEYRAAGEPLPAVVPAGPDNPM
GLYALYIGRLYAIHGTNANFGIGLRVSHGCVRLRNDDIKFLFENVPVGTRVQFIDEPVKA
TTEPDGSRYIEVHNPLSTTEAQFEGKEAVPITLNKSILAVTNEPDVDQTVVQQAVQDRSG
MPVRLN