Protein Info for GFF7157 in Variovorax sp. SCN45

Annotation: Peptidase M20D, amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR01891: amidohydrolase" amino acids 14 to 384 (371 residues), 355.3 bits, see alignment E=2.1e-110 PF01546: Peptidase_M20" amino acids 72 to 393 (322 residues), 148.1 bits, see alignment E=3.4e-47 PF07687: M20_dimer" amino acids 186 to 279 (94 residues), 40 bits, see alignment E=3.3e-14

Best Hits

Swiss-Prot: 42% identical to HIPO_CAMJE: Hippurate hydrolase (hipO) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 96% identity to vpe:Varpa_5955)

Predicted SEED Role

"Metal-dependent amidase/aminoacylase/carboxypeptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (400 amino acids)

>GFF7157 Peptidase M20D, amidohydrolase (Variovorax sp. SCN45)
MNIADSFADISRFVEIRRDIHAHPELGFEEHRTSEKVAKLLAEWGIEVHRGIAGTGLVGV
LRKGTGNRTIGLRADMDALPLHEANEFAHKSTNPGRMHACGHDGHTTMLLAAAWHLSQQG
PGDFDGTVHFIFQPAEEMGKAGAKKMIDEGLFERFPCDAVFGLHNFPVGDVGRFALNEGA
LMASSNTYKITVHGRGTHASMPHTGIDPVAAVVNLAQQLQIIVARTIPSTERALLAVTQL
QGSDAPNVIPDVATVGGTIRTFSIEAIDKIEARLREVAAGVAAAHGCTAEVYFNRSSPPT
VNHAAEARFAANVMREVVGDDMVTDNFPAVMGAEDFAHMLLARPGCYAFLGNGDGDHRLD
GHGPGPCIIHNTSFDFNDEIIPIGASYFVKLVQRWLPSGA